KEGG   Zymoseptoria tritici: MYCGRDRAFT_85668Help
Entry
MYCGRDRAFT_85668  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ztr  Zymoseptoria tritici
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCGRDRAFT_85668
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCGRDRAFT_85668
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCGRDRAFT_85668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 820 aa AA seqDB search
MPENGNGPSRPTKLPLDTDLALSMPKPPSPTYSPARNMQTTGNIAPPRHSARSLAGSGSR
KSSLGPLSSASSVAPNSTVDYYGSSQTNGNSSPSLARKNSVHMPKDTEISAQMLYDYLPR
FEVLLIDFRPREDFDQGHIYTRNVICIEPLTVRQGMSAEELSEGLILSPEEEVDLFNRRD
SFDVVVYYDADTRSDDFLARPRTDREQRLKWLHEALDEFNQDRPLQRRPSLLIGGIEAWA
DLLGNQALVASNTKARTGPARSLVRRPAARDGPMKVQKRRLRDYNPLDPEEERTWRARAK
SESVKENPVLATDGGEDEEDVVQDEDGASLPKYPTIEDFNSRFPDAGTLGQQYYNGRPAR
PPPEAPNNVPRYPSAPPPSQFPPAPARPAPAAPRMSYTGVSDRAVSQNTPAPRTSSQLVP
YISPKYLSANLRIPKTGLKNFGSTCYMNATLQALSATIPLTILVMDDGYKNMVQKENWKG
SRGLLPEMYSNVVRELWRGNVDFIKPTTFFNFCGRLNSTFKDPSQQEDTQEFFSFVVDCL
HEDFNAHWAKPPLRELTPAEEATRERMPRLLVAKTEWDRYTHRENSFLTSIFYGQQSSRV
RCTVCNATSTQYDPWALLQVEIPEAREAQLQDCLRNHFGDELLDADNQWTCTNCKVPRRA
TKKLTITRAPPFLVIGLKRFKTHPRTGEQRKIHTNVRFPLEGLDMGEFILPPPSLQEAEI
IVSQHGGREALKTDPALTPPYIYDAYAVVRHQGDTTRSGHYTAAVRDRARGCWRFFNDTV
SNDFRPEGLGRDKALDNEGAYLVFWQRRGLGGTGGGGEKM
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgccagagaacggcaatggcccatcacgacccaccaagctcccgcttgataccgatctc
gccctttccatgccgaagccaccgagtccgacgtacagtccagcgcgcaatatgcagacg
acggggaatattgctccgcctcgtcacagcgcaaggagtttagcagggtccggcagtcga
aagtcgtccttgggtccactgtcatctgcatcgtcggtggctcccaacagtactgtcgat
tattacggaagttcccaaacaaatggaaactcttctccgtcactcgcgcggaagaactct
gttcatatgcccaaggacaccgagatcagcgcacaaatgctgtacgattatttacctcgt
tttgaggtcttgctgatcgactttcgcccgcgggaggacttcgaccagggacacatctac
actcgcaacgtcatctgcattgagcctttgacggtgcgccagggcatgagcgctgaggaa
ttgtctgaaggactcatattgtcaccggaggaggaagtggatcttttcaatcgtcgagat
tccttcgacgtcgtggtctactatgacgccgacactcgatccgacgacttcctagctcga
ccgcggacggatagagagcaacggctcaagtggttgcatgaagccttggacgaattcaat
caggataggcctctgcaacgacgaccaagtttgctcattggcggtatcgaagcttgggct
gatcttctaggtaaccaagcattggtggcgtcaaacacaaaagcgaggactggtccagcg
cgatcgcttgtccgccgacctgcggcgagggatggaccgatgaaagttcaaaagcgccgc
ttacgagactacaatccgctggatccggaggaggaacgtacttggcgagctcgtgcgaag
agtgagagtgtaaaagaaaacccggttctggctacagatggaggtgaggatgaagaggat
gtggtccaagacgaggatggcgcatccttgccaaagtatcccacgattgaagatttcaac
tcacggttccccgacgctggaactctcggacaacagtactataacggaagaccggctcgc
ccacccccagaagcgcccaacaatgtgccaagatacccatcagcaccgccaccttcgcag
ttccctccggcacctgctcgtccggcacctgcagcgcctcgaatgagctacactggtgtt
agcgatcgggcagtctctcagaacactccagcaccgagaacctccagccagcttgtgcct
tatatctctccgaagtatctgtcggcgaatctacgcatacccaagactggcctgaagaac
ttcggcagcacttgctacatgaatgccaccctccaagccttgtctgcgaccatacctctt
acgatccttgtaatggacgatggatacaagaacatggtccagaaggagaattggaaaggc
agccgcggtctcctgcccgaaatgtatagcaatgtggtccgcgagctctggaggggaaat
gtcgatttcatcaaaccgaccactttcttcaatttctgcggccgcctcaacagcaccttc
aaagaccccagtcaacaggaagacacgcaagaattcttctcctttgtcgtcgactgtcta
cacgaggactttaacgcccactgggccaaacctcctctccgcgagctcaccccagccgaa
gaagctacacgagaacgcatgccgcgcctcttggtcgccaaaaccgaatgggaccgctac
acgcaccgcgagaactccttcctcacctccatcttctacggtcaacaatcctcccgcgtg
cgctgcaccgtctgcaacgccacctcgacccaatacgatccctgggcactcctccaagtc
gagatcccggaagcccgcgaagcacaactgcaagactgtctgcgcaaccacttcggcgac
gaactcctcgacgccgacaatcaatggacctgcacaaactgcaaagtaccccgccgcgcc
acgaagaaactcaccatcacccgcgccccacctttcctggtcatcggcctcaaacgcttc
aaaacccaccctcgaaccggcgaacagcgcaaaatccacaccaacgtgcgcttcccgctc
gaaggcctcgatatgggagaatttatccttcctcctccttcgctgcaggaagcggagatt
atcgtctcccaacacggcggacgggaagcgttgaagacggaccccgcgttgacgccgccg
tatatctatgatgcgtatgcagtggtgagacatcagggcgatacgacgcggagtgggcat
tatacggccgcggtgagggatcgggcgaggggatgttggcggttttttaatgatactgtt
tcgaatgattttcgaccggaagggttgggaagggataaggcgctggataatgagggggcg
tatttggtgttttggcagaggaggggcttgggtgggacgggaggtggtggggagaagatg
tga

DBGET integrated database retrieval system