KEGG   Zymoseptoria tritici: MYCGRDRAFT_87833Help
Entry
MYCGRDRAFT_87833  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ztr  Zymoseptoria tritici
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCGRDRAFT_87833
Enzymes [BR:ztr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     MYCGRDRAFT_87833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 444 aa AA seqDB search
MNRRRKSSNLGGDPRGDTGATAFATMNLSLRHQDTSSPTTTSSSGKPLRQSKRRKAKTLL
NRFKRTSLKHTWVIPLILVVVILGLYYIDPGEHNPVHHAIFLSYANPPLDERTDTLPAHV
GNVTQYGKGPKDIAFVAFYTIVLSFTREFLMQRMIQPIAIWCGIRSRAKLSRFMEQFYTA
IYFGIFGPFGLYVMSRTPVWYFNTAGMYEGFPHRAHEGLFKAYYLLQASYWAQQGLVLML
QLEKPRKDFKELVLHHIVTLSLIGLSYCFHFTYMGVAVYITHDISDFFLATSKVFNYLDL
WIITPYFAIFIAVWAYLRHYINLTIIMSLLPGGQFETVGPYQVNWETQQYKCWISQAITF
GLLAVLQAVNIFWFVLILRILYRLLVTSEAKDERSDDEEEEDDLQPLAPEADKGTPQMTL
NGEPFNQTEASGADVNRKASLRKR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgacgacgaaagagctccaatctgggcggagatcctcgcggagatacgggcgcg
acagcattcgcgacgatgaatctatcgctgcgacatcaagacacctcgtcgccgactacg
acttcatcctcgggaaagccgctgcgacaatcgaaacgacgaaaggcaaagacgttgttg
aaccggttcaagcgtacgtcgcttaagcacacgtgggtcataccgctcatcctcgttgtg
gtcatccttggcctctactacatcgatccgggcgagcacaaccctgtacaccacgccatc
ttcctgtcctatgcgaatccccccttggacgagcgaacggacactcttccagcacatgtc
ggcaatgtcacgcagtatggcaaggggccgaaggatattgcgttcgtcgctttctacacc
atcgtgctgtcttttacgagagagttcttgatgcagcgtatgatccagccgattgcgatt
tggtgtggtattcggtcaagagcaaagctgagtcgcttcatggaacaattctacactgct
atctatttcggcatatttggaccctttgggctgtatgtgatgagccggacacccgtgtgg
tacttcaacacggctggaatgtatgagggattcccgcatcgtgctcatgagggactgttc
aaggcatactacctccttcaagcgtcgtactgggctcagcaaggcttggtcctgatgttg
caattggagaagccgaggaaggacttcaaggagctggtcttacatcacatcgtcacattg
tctctgatcggtctgagctactgttttcacttcacctacatgggcgttgcggtatacatc
acacacgacatttctgacttcttcctggctacgtccaaagtcttcaactacctggacctc
tggatcatcacgccgtacttcgccatcttcatcgcagtatgggcatatctccggcattac
atcaaccttacaatcatcatgtcgctgttgccgggcggtcaattcgagactgttggccca
taccaagtaaactgggagacgcaacagtacaaatgctggatctcgcaagccataaccttt
ggactgctggcagtcctacaagccgtcaacatattctggttcgtcctgatcttgagaatc
ctgtaccgactgctcgtcacaagcgaggcgaaagacgagagatccgatgatgaagaggag
gaagacgacctgcagcctctcgctccggaagcggataagggcactcctcagatgacgctg
aatggcgagcctttcaaccagactgaagcttctggggctgacgtcaaccgcaaggcttcc
ctgaggaagagatga

DBGET integrated database retrieval system