KEGG   Zymoseptoria tritici: MYCGRDRAFT_91335Help
Entry
MYCGRDRAFT_91335  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCGRDRAFT_91335
Peptidases [BR:ztr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MYCGRDRAFT_91335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 257 aa AA seqDB search
MAPQPTTPGVTINAAGKKSFIPLENNPEVFTSLMHNLGVSSKLTCHDIYTLDRSFLATIP
RPVHALIFIAPGPVYHRVRARHDGGTGSGSRVDEHITYDATGPDEPILWFRQTIGNACGL
YSLVHAVGNGSARAHVQPDTLIDRLLKQAEPLHRVKRAAVLYDSLELERVHMAAAVEGDS
HAPESQEKVGYHFITFVKGKDGHLWELEGSWDPIDRGVIEEGEDLLSERVVEMGVGKFVE
EAEGNVGFSVVAVVTEE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcaacccaccacaccaggcgtcaccatcaacgcagccggcaaaaagtccttc
atcccactcgaaaacaaccccgaagtcttcacctccctcatgcacaacctcggcgtctcc
tccaaactcacctgccacgacatctacaccctcgaccgctcgttcctcgccaccatcccc
cgacccgtccacgctctcatcttcatcgctccaggacccgtctaccaccgcgtgcgcgcc
cgccacgacggcggtaccggcagcggtagtagagtagacgaacacatcacctacgacgcc
acgggaccagacgagccgattctctggttccgacaaacgatcgggaatgcatgcggtttg
tactcgctcgtgcacgctgtaggtaatggatcggcgagagcgcatgtccagccggacaca
ctcatcgatcgactgctcaagcaagcggagccgttgcatcgagtcaagcgcgcggcggtg
ttgtacgactcgctggagctggagagggtgcatatggctgctgcggtggagggcgattca
catgcgccggagagccaggagaaggtcgggtatcactttattacgtttgtgaaggggaag
gatgggcatttgtgggagttggaggggagttgggatccgattgatcgtggggtgatagag
gagggagaggatttgttgagtgagagggtggtggagatgggggtgggcaagtttgtggag
gaggcggagggtaatgtgggattttctgttgtggcggtcgtgacggaggagtga

DBGET integrated database retrieval system