KEGG   Zymoseptoria tritici: MYCGRDRAFT_92113Help
Entry
MYCGRDRAFT_92113  CDS       T02285                                 

Gene name
MgBGN16.1
Definition
(RefSeq) putative endo-beta-1,6-glucanase
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     MYCGRDRAFT_92113 (MgBGN16.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3
AA seq 480 aa AA seqDB search
MHIQTFLALAGSATLTCGLALQERASAAAYTTDKDLNYKNSPIGAPVSGNGSPNGRATWK
LNIDDTSSGCKQTIDGFGGCVTDATVTSFNTLSSGAQSSLLKEMSHFSLLRHTIASSDLS
GDPAYTYDDNGGNADPSLSGFNLGDRGNAMTTLLKSMKNLNSKIKILGSPWSAPGWMKLN
KVITGTTNQNNLNDGYLDNSGPGYSQAFAQYFVKYIQALNNRGVSIDAITVQNEPLNSNA
GFPTMYMFDYEQAQLVNNYVGPALRNAGIGADVWAYDHNTDHPEYPERVINGAGNYVGAA
AWHCYAGTLNWTVLTDFHNKFPNKKQYMTECYTTNTTGLNWVAGFVMGPLQNWASGSIAW
TLGTTDKNGPYLSAETGPCKVCRGLFTTSNGNYQLNVDYYVMAQFSKYIPVGATVLSGSG
SYNFDNGGIQSVATRNPDGSRTVVIHNSFSNDVYVTLTTKSGQTWSGNTPANSVTSWILP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccaaacatttcttgccctcgccggctcggccaccctgacttgtggtctagct
ctacaggagcgggcaagtgctgcagcgtacaccacagacaaggacctcaactacaagaac
tcgccgattggcgcacccgtctctggaaacggcagtccaaatggcagagcaacttggaaa
ctcaacatcgacgacacctcgtcaggttgcaagcagacgatcgatggctttggtggctgt
gtcaccgacgcaacagtgaccagtttcaataccctatcgagcggtgcacagagctctcta
ctcaaggaaatgtcccacttcagcttactacgacacacgatcgcatcttccgacctctct
ggtgacccggcttacacatacgacgataacggtggcaacgcggacccctcattgtctggc
ttcaacctcggagaccgtggcaatgccatgaccaccctgctgaagtcgatgaagaatttg
aactccaagatcaagattcttggaagtccatggagtgctcctggctggatgaagctgaac
aaagtgatcactggaacgactaaccaaaataatttgaacgacggctatctggacaatagc
ggtcctggatattctcaggcgtttgcacagtacttcgtgaagtacattcaggctctcaat
aaccgtggcgtgtcaatcgacgccatcaccgtccagaacgaaccgctgaactccaatgca
ggattcccgaccatgtacatgtttgattatgagcaggcccaattggtcaacaactacgtc
ggtcctgcattgaggaatgccggaataggcgcagacgtttgggcctacgatcacaacact
gatcacccagaataccccgagcgagtgatcaacggtgcgggcaactacgtcggcgccgca
gcctggcactgctacgccggcaccttgaactggacagtcctcacagatttccacaacaag
ttccccaacaagaaacaatacatgacagagtgttacacgacaaacaccactggactgaac
tgggtcgccggcttcgtcatgggtccactccagaactgggcttcgggcagcatcgcttgg
actctcggcaccacggacaagaatggaccgtatctctctgctgaaactggaccctgcaag
gtttgccgtggtttattcacgactagcaacggcaactaccagcttaatgtcgactactac
gtgatggcgcagttcagcaagtatattcccgttggcgccactgtgctcagcggaagtgga
agctacaacttcgacaatggcggaattcaatctgttgctacgagaaatccggatggtagc
cgtacggtggttattcataactctttttcgaatgatgtatatgttacgttgacgaccaag
agtggacagacttggagtgggaatacaccggcgaactcggtcacttcttggatcctgccg
tag

DBGET integrated database retrieval system