KEGG   Zymoseptoria tritici: MYCGRDRAFT_94846Help
Entry
MYCGRDRAFT_94846  CDS       T02285                                 

Gene name
MgXYN1
Definition
putative endo-beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ztr  Zymoseptoria tritici
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 370 aa AA seqDB search
MLLTNTTAQHIDFIMLLTNSVLAALAMAGNAVATPHAPKPKGLWEAMQSRGRDWIGTAVT
FRNDTVEASIYGNKADFNSITPENDMKWGLTEPQQNNFTLAGADKYADYARKHGVQIHCH
NLVWHSQLPDWVANGNFTKAELTAVMKNHIDTLAGRYKDVCTRWDVVNEALEENGTYRNS
VFYRVLGEDFLPIAFKLAHAASPKSKLFYNDYSLEGSDVKAAGAQRIVKYIQSKGGPIHG
VGFQAHLTSEPTTSSGGGVAPGRVELTNRLQSFTALGVDVAYTELDVRMNTPATPAKTAV
QAEVYYNVSSSCLATKRCVGMTLWGVSDKYSWIPGTFPGEGSADVWDENLQKKKTVYQRF
LDGILCGGKK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgaccaacacgaccgcacagcatatcgacttcatcatgcttctcacaaacagc
gtcctcgccgccttggcgatggctggcaatgccgtcgcaacgccacatgcaccgaaaccc
aaaggtctctgggaagccatgcaatcccgcggccgcgactggatcggaaccgccgtcaca
ttccgcaacgacacagtggaagcatcgatctacggcaacaaagctgacttcaactccatc
actccggagaacgacatgaagtggggtctcaccgagcctcagcaaaacaacttcaccctc
gctggcgcggacaagtatgccgactacgctaggaagcacggcgtgcagatccattgccat
aatttggtgtggcatagtcagctgcctgattgggttgccaatggaaacttcaccaaggct
gagctcactgctgttatgaagaatcatattgatacgcttgcggggcggtataaggacgtt
tgcacgagatgggacgtcgtaaacgaagccctggaagaaaatggaacctaccgcaacagc
gtcttctaccgcgtcctcggcgaagatttcctccccatcgccttcaagctcgcccacgcc
gcctcaccaaaatccaaactcttctacaacgactacagcctcgaaggttccgacgtcaaa
gccgccggagcccaacgcatcgtcaaatacatccagtcgaagggtggaccaattcatggc
gtcggatttcaagcacatctcacctctgagccgaccacgtctagcggaggcggtgttgca
ccaggacgagtcgaactcacgaacagactgcagagctttactgctctgggtgtggatgtt
gcttatactgagttggatgtgaggatgaatactcccgcgactccggcgaagacggcggtt
caggctgaggtgtactataatgtttcgtccagttgtcttgcgacgaagagatgtgttggt
atgaccctttggggcgtctccgacaaatactcttggattcctggtacctttcccggagaa
ggttccgcggatgtctgggacgagaatctgcagaagaagaagacagtctaccagagattc
ctggatggaattctgtgcggaggcaagaagtga

DBGET integrated database retrieval system