KEGG   Zymoseptoria tritici: MYCGRDRAFT_95717Help
Entry
MYCGRDRAFT_95717  CDS       T02285                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ztr  Zymoseptoria tritici
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MYCGRDRAFT_95717
   03420 Nucleotide excision repair
    MYCGRDRAFT_95717
   03430 Mismatch repair
    MYCGRDRAFT_95717
   03440 Homologous recombination
    MYCGRDRAFT_95717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 280 aa AA seqDB search
MDYGYSTTSYGAQGGASGGGFMPGSQSANDNSATKRTGYGKDTLRPVTIKQLLDAHHPHP
DADHFMVDDTEMTQVTFIGQIRNISTQTTNVTYKMDDGTGSIEVKVWIDAEAFEPAEGGG
GGGGKQKPVEQGYARVWGRLKAFNNKRHVGAINVRPIQDFNEISYHLLEATVVHLQLTKG
PPGGGNEGQQPGANGYGQQLAQQNGGGGGGGDISGVSASARKVYSCLKSTPQTNEGLHAQ
DIAGRVNMELSEVMKAGDELLGLGRVYTTVDDATWAILEI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggactacggctactccaccacctcctacggcgcccaaggcggagcctccggcggcggc
ttcatgccgggctcgcagtccgccaacgacaacagcgcaaccaaacgcaccggctacggc
aaagacaccctccggcccgtcaccatcaaacaactcctcgacgcgcaccacccacacccc
gacgccgaccacttcatggtcgacgataccgaaatgacccaagtcaccttcatcggacaa
atccggaacatctccacgcaaacgaccaacgtgacgtataaaatggacgacggcacgggg
agtattgaagtcaaagtgtggattgacgcggaagcgtttgagcccgcggaaggaggagga
ggaggaggagggaagcagaaaccggtggagcaggggtatgcgcgggtgtggggacgactg
aaggcgtttaataataagcggcacgtcggggcgattaatgtgcggccgattcaggacttc
aatgagatttcgtatcatttgctggaggcgacggtggtgcatttgcagcttaccaagggg
ccgcccggaggaggcaacgagggacaacaaccgggtgcgaacgggtatggacaacaactg
gcgcagcagaatggaggtggtggtgggggaggggatatctcgggggtgagtgcgtcggcg
agaaaggtgtattcgtgtttgaagagtacgccgcagacgaatgaggggttgcatgcgcag
gatattgcggggagggtgaatatggagttgagtgaggtgatgaaggcgggggatgagttg
ttggggttggggagggtgtataccacggtggatgatgcgacgtgggcgattttggagatt
tga

DBGET integrated database retrieval system