KEGG   Zymoseptoria tritici: MYCGRDRAFT_98798Help
Entry
MYCGRDRAFT_98798  CDS       T02285                                 

Definition
dolichyl-phosphate-mannose--protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ztr  Zymoseptoria tritici
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    MYCGRDRAFT_98798
Enzymes [BR:ztr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     MYCGRDRAFT_98798
Glycosyltransferases [BR:ztr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   MYCGRDRAFT_98798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 779 aa AA seqDB search
MSSPQSTVRQRGPKDKSRPVTPNAAALNGKVEDTLDSVKKSGKEAVKSEWDYKLGFTIIT
ILAFLTRFWGISHPDQVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFAGWLVGYDG
SFLFENIGDSYITNHVPYVAYRSMPALMGALTVSTVYLIMWESGYSLPAAILASSLVLFD
NAHIGQTRLILLDATLVLFMALSILCYIRFYKLRHAPFGRKWWKWLLLTGVCMSCVISTK
YVGAFTFFSIGVPVLIDLWELMDVNRKQGALTLPTFFKHFAARVIGLIIVPFMMYLFWFQ
VHFAILSRSGPGDDFMTPAFQETLSDNLMSQNAVSIEYFDNISMRHKDTKVYLHSHVDKY
PLRYDDGRVSSQGQQVTGYPHNDTNNLWQILPSNGVEGTGHKVRTGDHVRLRHLVTDSYL
LTHDVASPFFPTNQEFTAVPIEQANGDRYNDTLFEIRVDEKKIGQEFKTLASHFKLVHVP
TKVAMWTHTKPLPDWGYKQAEINGNKNAAQTSNLWYAEDIQGIPADSPRLVKTIRKPKSM
PFLKKYIEVQRAMFYHNNALTSSHPYASQPIQWPFLLRGVSFWTENETKRQIYFMGNPLG
WWFASSVLAIFAGILFADQMSVRRGVDALDRRTRSRLYNSTGFFFLVWGAHYLPFFIMGR
QLFLHHYLPAHLASCLVAGAIVEFVFNIEPQDLTRVSSTNPITDGKKDSAAQAAQRAKPI
RERIAGQSLMATWAASGVLVSILVWSFWYFSPLTYGKPGLTVAQVLARKWLNYDFHFAK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctccccagagcacggtccgccaacgagggcctaaagacaagagtcgcccagtg
acaccgaacgcagccgcattgaatggcaaggtcgaggataccttggactcggtgaaaaag
tcgggaaaagaggctgtcaagagtgaatgggactacaagcttggtttcacaatcatcacg
atcctcgcattcctgacgcgcttctggggcatcagccatcccgaccaggttgtgttcgat
gaggtgcactttggcaagttcgcctcgtattacctccaacgcacctacttcttcgatgtc
caccctccctttggcaagctacttttcgcattcgccggctggctcgttggatacgatggc
tccttcctcttcgagaacatcggcgactcgtacatcaccaaccacgtgccttacgtggca
taccgatccatgccagcgctgatgggcgcgctgacagtttcaactgtatacctgatcatg
tgggagtctggatacagtctgcctgctgccatcctggcctcttcgctcgtgcttttcgac
aacgcgcacattggtcagactcgtctgattctcctcgacgcgactctagtgctgttcatg
gcgctgagcatcctttgctacattcgattctacaagctccgccacgcgccattcggaagg
aagtggtggaagtggctcctgctcactggagtatgcatgagctgtgtcatcagcacgaaa
tacgtgggagctttcaccttcttctccattggcgtgccggtcttgatcgatctctgggag
ttgatggatgtcaaccgcaagcaaggagctctgacgctgccgacattcttcaagcacttt
gctgcacgtgtcatcggtctgatcattgtgcccttcatgatgtacctgttctggttccaa
gtgcactttgcgattctgtctcgatcgggtcctggcgacgatttcatgactccggccttc
caggagacgctctcggacaacctcatgtcgcaaaatgctgtgagcattgagtactttgac
aacatctccatgcgtcacaaggacaccaaggtttatctgcactcgcatgtggacaagtac
ccgcttcgctacgatgatggccgcgtttcgtctcagggtcagcaggttactggataccct
cacaacgacaccaacaacctgtggcagattctcccgtcgaatggtgtggaaggcacgggt
cacaaggtcaggactggcgaccacgttcgtcttcgccatctcgtcaccgattcttacctg
ctcactcacgatgttgcgtctcccttcttccctaccaaccaggaattcaccgcagtccca
atcgagcaggcgaatggagatcgatacaacgacactctctttgagattcgtgtcgacgag
aagaagattggacaggagttcaagacactcgcatcgcattttaagctcgtccacgttcct
accaaggtcgccatgtggacgcacaccaagcctttgcctgactggggttacaagcaagcc
gagatcaatggcaacaagaatgccgcgcagacgtcgaacttgtggtacgccgaagacatc
cagggcattccggccgactcgcctcgattggtcaagacgatccgcaagcccaagagcatg
ccattcttgaagaagtatattgaggtccagcgggccatgttctaccacaacaacgcgttg
acatcgtctcacccgtacgcatcgcagccaattcagtggccattccttctccgcggcgtc
agcttctggacggagaacgagaccaagcgtcaaatctactttatgggcaatcctctcgga
tggtggttcgcatcgtcggttttggcgatcttcgccggcattctgttcgcggatcagatg
tctgtccgccgtggcgtcgacgctcttgacagacgcactcggtctcgtctctacaacagc
acgggtttcttcttcctcgtttggggcgcccactaccttcccttcttcatcatgggtcgc
caactcttcttgcaccactacctgccagcacacttggcttcctgtctcgtggccggcgcg
attgttgaattcgtcttcaacatcgagccgcaagacctcacccgcgtgtcctcaaccaac
cctatcacggacggcaagaaggacagcgctgcgcaagctgctcagcgcgccaagccgatc
cgcgaacgtattgcgggtcagagcttgatggcgacgtgggcggcgagtggagtgttggtt
tcgatactggtgtggagtttctggtactttagcccgttgacgtacggcaaacccggattg
accgttgcgcaagtgttggcaaggaagtggttgaactacgacttccactttgcgaagtag

DBGET integrated database retrieval system