KEGG   Zymoseptoria tritici: MYCGRDRAFT_99393Help
Entry
MYCGRDRAFT_99393  CDS       T02285                                 

Gene name
PFK
Definition
(RefSeq) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCGRDRAFT_99393 (PFK)
   01230 Biosynthesis of amino acids
    MYCGRDRAFT_99393 (PFK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCGRDRAFT_99393 (PFK)
   00030 Pentose phosphate pathway
    MYCGRDRAFT_99393 (PFK)
   00051 Fructose and mannose metabolism
    MYCGRDRAFT_99393 (PFK)
   00052 Galactose metabolism
    MYCGRDRAFT_99393 (PFK)
  Energy metabolism
   00680 Methane metabolism
    MYCGRDRAFT_99393 (PFK)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MYCGRDRAFT_99393 (PFK)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYCGRDRAFT_99393 (PFK)
Protein phosphatases and associated proteins [BR:ztr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYCGRDRAFT_99393 (PFK)
Messenger RNA biogenesis [BR:ztr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MYCGRDRAFT_99393 (PFK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 765 aa AA seqDB search
MAQITLNPPKVDAGGKRVAVMTSGGDSPGMSPFVRAVVRQLLAEGCTAYAVYEGYQGLVD
GGDMIKEMAWEDVRGWSSEGGTLIGTARCKAFMERAGRLVAANNMIEKGIDALIVCGGDG
SLTGADKFREEWPSLLDELVSTGKRKEEAIERHRHLNIVGAVGSIDNDLSGTDATIGCYS
SLQRICQSIDYIDSTALSHQRAFVIEVMGRHCGWLAMASAVSCGADFVFTPENPPSENWQ
EDMCKVIKKHREMGKRKTIVIVAEGAHDRDLNHISPDMVKDLLSGTVGLDTRVTTLGHVQ
RGGPPCAYDRMLATLQGVEAVKAALEATPETPSPVICILENKIVRKDLMEAIRLTKQVAV
DIGKKDFAAAMKGRDAEFEELLQAFRVTTEAEKGVLRIPEEKRMRIGIIHVGAPAGGMNA
ATRAAVAYCLSRGHTPVALHNGFPGLVRHHDDKPLGSVREVSWLDAENWGSKGGSEIGTN
RDLPSDERCGLKNVAFCLEKYKIDALYIPMVVLPATISNNVPGTEFSIGSDTCLNALIDY
CDSIKQSASASRRRVFVVETQGGASGYIATIAGLCIGAIAVYTPEEGIHLNMLVEDIKFL
KEQFAKDIGHAKSGKIILRNEKASKVYSTEFIAEAIKEESGGKFDSRFAVPGHVQQGGTP
SPMDRVRAVRFAIKSLQHLESFAGKSKQEIADDPLSVTVIGMKGARVKVRDMEKIEREDT
DWKDRRPKDEFWMALVDVVDTLSGRPKSTRSPIPGGSPAMNGTAK
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatcacgctcaacccgccgaaggtcgacgctggcggtaagcgtgtggccgtc
atgacctccggaggtgactcgccaggcatgagtccatttgtccgagctgtggtccgtcaa
ctactcgccgaagggtgcacggcgtatgcagtctatgaagggtaccaaggactggtcgat
ggaggtgacatgatcaaagagatggcatgggaagatgtgcgaggctggagctcagaaggt
ggcacacttatcggtactgctcgttgcaaagcattcatggaaagagctgggcgactggtc
gctgcgaataacatgatcgagaagggcattgacgctctgattgtgtgtggtggagatggc
tctctgactggagcggacaagtttcgagaggagtggccgagtcttttggacgaactcgta
tccaccggaaagcgcaaggaagaggctattgaacgacatcgccatctgaacatcgttgga
gcggtgggctcaatcgacaatgatctcagcggaacggatgccacgattggatgctacagc
tcactgcagcgtatatgtcagtcgatcgactatatcgactcaacagccctttctcaccaa
cgcgcattcgtcattgaggtcatgggcagacactgcggatggcttgccatggcctccgct
gttagctgcggcgccgatttcgtgttcacgccggagaatccaccctcagaaaactggcaa
gaggatatgtgcaaggtcattaagaagcatcgtgagatgggcaaacgaaaaacgattgta
attgttgctgaaggtgctcatgatcgcgatctcaaccacatctcgccggacatggtcaaa
gacctgctgtcagggacagtcggtctggacacaagagtgacaacgctcgggcacgtccaa
cgtggtggtccgccttgcgcctacgatcgaatgcttgctactttgcagggtgtggaggct
gtcaaggcggcgctggaagcgacaccggagacaccctcgcctgtcatttgcattctggag
aacaagattgtccgcaaagacttgatggaggccatcagattaacaaaacaagttgcagta
gatatcggcaagaaagacttcgctgcggcaatgaaaggaagagacgcagagttcgaagag
ctgttgcaagctttccgagtcaccaccgaggctgagaagggcgtcttgcgcattccagag
gagaagcgcatgcggattggtatcatccacgtcggcgctcccgcaggaggcatgaacgca
gccactcgtgccgcagtggcatattgtctaagccgagggcacacccctgtcgcgctacac
aacggattccctggcctggttcgccatcacgacgacaagccattgggatctgtgcgagaa
gtatcatggcttgatgccgagaactggggttcaaaaggtggttctgagatcggcacaaat
cgagatcttccatctgatgagaggtgcggtctcaagaatgtcgccttctgtctcgagaag
tacaagatcgacgccctatatatccccatggtcgtcctccctgccacaatctccaacaac
gttcctggtactgagttctccatcggctccgacacctgtctaaatgcgctcatcgactac
tgcgactccatcaaacagtctgcctccgcctcccgccgccgcgtcttcgtcgttgaaacg
caaggcggcgcatctggctacatcgctacgatcgctggtctatgtatcggcgccatcgca
gtctacacacccgaagaaggcatccacctcaatatgctggtcgaagacatcaaattcctc
aaggagcaattcgccaaagacatcggtcatgccaagtcagggaagatcatcctccgcaac
gaaaaggccagcaaagtctactccaccgaattcattgccgaagcaataaaggaggaatcc
ggaggcaaatttgactcccgctttgcggttcccggccacgtccagcaaggcggtacacct
agtccgatggaccgcgtccgagccgtgcgtttcgccatcaagtcgctgcaacatctggag
agcttcgcgggcaagtcgaagcaggagatcgctgacgatccgctttcggtgacggtcatt
ggcatgaagggtgcgcgggttaaggtgagagacatggagaagatcgagagggaggatacg
gattggaaggaccgaagaccgaaggatgagttctggatggcgctggtggatgttgtggat
acgttgagtgggaggccgaagtcgacaaggtcgccgataccaggcgggagtccggccatg
aatgggacggcgaaatga

DBGET integrated database retrieval system