KEGG   Zymoseptoria tritici: MYCGRDRAFT_99393Help
Entry
MYCGRDRAFT_99393  CDS       T02285                                 

Gene name
PFK
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ztr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ztr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ztr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ztr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ztr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ztr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ztr00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 765 aa AA seqDB search
MAQITLNPPKVDAGGKRVAVMTSGGDSPGMSPFVRAVVRQLLAEGCTAYAVYEGYQGLVD
GGDMIKEMAWEDVRGWSSEGGTLIGTARCKAFMERAGRLVAANNMIEKGIDALIVCGGDG
SLTGADKFREEWPSLLDELVSTGKRKEEAIERHRHLNIVGAVGSIDNDLSGTDATIGCYS
SLQRICQSIDYIDSTALSHQRAFVIEVMGRHCGWLAMASAVSCGADFVFTPENPPSENWQ
EDMCKVIKKHREMGKRKTIVIVAEGAHDRDLNHISPDMVKDLLSGTVGLDTRVTTLGHVQ
RGGPPCAYDRMLATLQGVEAVKAALEATPETPSPVICILENKIVRKDLMEAIRLTKQVAV
DIGKKDFAAAMKGRDAEFEELLQAFRVTTEAEKGVLRIPEEKRMRIGIIHVGAPAGGMNA
ATRAAVAYCLSRGHTPVALHNGFPGLVRHHDDKPLGSVREVSWLDAENWGSKGGSEIGTN
RDLPSDERCGLKNVAFCLEKYKIDALYIPMVVLPATISNNVPGTEFSIGSDTCLNALIDY
CDSIKQSASASRRRVFVVETQGGASGYIATIAGLCIGAIAVYTPEEGIHLNMLVEDIKFL
KEQFAKDIGHAKSGKIILRNEKASKVYSTEFIAEAIKEESGGKFDSRFAVPGHVQQGGTP
SPMDRVRAVRFAIKSLQHLESFAGKSKQEIADDPLSVTVIGMKGARVKVRDMEKIEREDT
DWKDRRPKDEFWMALVDVVDTLSGRPKSTRSPIPGGSPAMNGTAK
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatcacgctcaacccgccgaaggtcgacgctggcggtaagcgtgtggccgtc
atgacctccggaggtgactcgccaggcatgagtccatttgtccgagctgtggtccgtcaa
ctactcgccgaagggtgcacggcgtatgcagtctatgaagggtaccaaggactggtcgat
ggaggtgacatgatcaaagagatggcatgggaagatgtgcgaggctggagctcagaaggt
ggcacacttatcggtactgctcgttgcaaagcattcatggaaagagctgggcgactggtc
gctgcgaataacatgatcgagaagggcattgacgctctgattgtgtgtggtggagatggc
tctctgactggagcggacaagtttcgagaggagtggccgagtcttttggacgaactcgta
tccaccggaaagcgcaaggaagaggctattgaacgacatcgccatctgaacatcgttgga
gcggtgggctcaatcgacaatgatctcagcggaacggatgccacgattggatgctacagc
tcactgcagcgtatatgtcagtcgatcgactatatcgactcaacagccctttctcaccaa
cgcgcattcgtcattgaggtcatgggcagacactgcggatggcttgccatggcctccgct
gttagctgcggcgccgatttcgtgttcacgccggagaatccaccctcagaaaactggcaa
gaggatatgtgcaaggtcattaagaagcatcgtgagatgggcaaacgaaaaacgattgta
attgttgctgaaggtgctcatgatcgcgatctcaaccacatctcgccggacatggtcaaa
gacctgctgtcagggacagtcggtctggacacaagagtgacaacgctcgggcacgtccaa
cgtggtggtccgccttgcgcctacgatcgaatgcttgctactttgcagggtgtggaggct
gtcaaggcggcgctggaagcgacaccggagacaccctcgcctgtcatttgcattctggag
aacaagattgtccgcaaagacttgatggaggccatcagattaacaaaacaagttgcagta
gatatcggcaagaaagacttcgctgcggcaatgaaaggaagagacgcagagttcgaagag
ctgttgcaagctttccgagtcaccaccgaggctgagaagggcgtcttgcgcattccagag
gagaagcgcatgcggattggtatcatccacgtcggcgctcccgcaggaggcatgaacgca
gccactcgtgccgcagtggcatattgtctaagccgagggcacacccctgtcgcgctacac
aacggattccctggcctggttcgccatcacgacgacaagccattgggatctgtgcgagaa
gtatcatggcttgatgccgagaactggggttcaaaaggtggttctgagatcggcacaaat
cgagatcttccatctgatgagaggtgcggtctcaagaatgtcgccttctgtctcgagaag
tacaagatcgacgccctatatatccccatggtcgtcctccctgccacaatctccaacaac
gttcctggtactgagttctccatcggctccgacacctgtctaaatgcgctcatcgactac
tgcgactccatcaaacagtctgcctccgcctcccgccgccgcgtcttcgtcgttgaaacg
caaggcggcgcatctggctacatcgctacgatcgctggtctatgtatcggcgccatcgca
gtctacacacccgaagaaggcatccacctcaatatgctggtcgaagacatcaaattcctc
aaggagcaattcgccaaagacatcggtcatgccaagtcagggaagatcatcctccgcaac
gaaaaggccagcaaagtctactccaccgaattcattgccgaagcaataaaggaggaatcc
ggaggcaaatttgactcccgctttgcggttcccggccacgtccagcaaggcggtacacct
agtccgatggaccgcgtccgagccgtgcgtttcgccatcaagtcgctgcaacatctggag
agcttcgcgggcaagtcgaagcaggagatcgctgacgatccgctttcggtgacggtcatt
ggcatgaagggtgcgcgggttaaggtgagagacatggagaagatcgagagggaggatacg
gattggaaggaccgaagaccgaaggatgagttctggatggcgctggtggatgttgtggat
acgttgagtgggaggccgaagtcgacaaggtcgccgataccaggcgggagtccggccatg
aatgggacggcgaaatga

DBGET integrated database retrieval system