KEGG   Zymoseptoria tritici: MYCGRDRAFT_99725Help
Entry
MYCGRDRAFT_99725  CDS       T02285                                 

Gene name
Tpk2
Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr04113  Meiosis - yeast
ztr04138  Autophagy - yeast
Module
ztr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    MYCGRDRAFT_99725 (Tpk2)
  Cell growth and death
   04113 Meiosis - yeast
    MYCGRDRAFT_99725 (Tpk2)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MYCGRDRAFT_99725 (Tpk2)
Protein kinases [BR:ztr01001]
 Serine/threonine kinases: AGC group
  PKA family
   MYCGRDRAFT_99725 (Tpk2)
Messenger RNA biogenesis [BR:ztr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MYCGRDRAFT_99725 (Tpk2)
Chromosome and associated proteins [BR:ztr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    MYCGRDRAFT_99725 (Tpk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like TFIIA
Motif
Other DBs
NCBI-GeneID: 13404547
NCBI-ProteinID: XP_003854076
JGI: Mycgr3_99725
UniProt: F9X6J7
Position
3
AA seq 461 aa AA seqDB search
MPSLGFLKKKRTKDSTASNEVASPTSPTIGSPISQTLSRQSNLFSEQNQQSQQQPPQTSG
QDSVQQNTSASQSSNAKADDPMNISPQPSAVQQQPAQPQQQYNGSQHDSAHEQNGHNPNQ
QHVPLLNVSKTAPTVNPLRETKGKYTLNDFQISRTLGTGSFGRVHLVQSKHNSRFYAVKV
LKKAQVYKMKQVEHTNDERKMLQRCRNPFLITLWGTWQDSKNLYMVMDFIEGGELFSLLR
KSQRFPNPVAKFYAAEVTIALDYLHSMNIIYRDLKPENLLLDRHGHIKITDFGFAKEVPD
ITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLAGFTPFWDSGSPLKIYENILK
GRVKYPPYIHPDAQDLLSKLITADLTKRLGNLHGGSQDVMNHAWFAEVTWDRLAKKDIDA
PYVPPVRGGAGDASLFDKYPEETEAYGATGDDPHRTLFPDF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgctgggcttcctcaagaagaagcgaaccaaggactctacagcgtccaacgag
gtcgcttcgcccacttcacccacgatcggctcgccaatatcacagaccttgtctagacaa
agcaaccttttttccgagcagaaccaacagtcgcagcagcagccgccgcagacatctggc
caagatagcgtacagcagaacacaagcgcctcgcaaagctcaaacgccaaagccgacgat
ccaatgaacatatcaccccaaccttcggcagtccagcagcagccagctcagccgcagcag
caatacaatggctcgcagcatgactctgctcacgagcaaaacggacacaacccgaatcag
cagcatgtgccactgttgaacgtgagcaaaacagcgccgacggtcaatccactccgcgag
acaaagggcaaatacacgctgaacgacttccaaatttcacgaacgctcggcacgggatct
ttcggacgtgtgcatctggtccagagcaagcacaattcacgattctacgcggtcaaggtg
ttgaaaaaagcacaggtatacaagatgaagcaagtggaacacacaaacgatgagcgcaag
atgctgcagcgatgccggaatccattcctcatcactctgtggggcacatggcaagattcg
aagaacttgtacatggtcatggactttattgaaggaggtgagctgtttagcttgttgagg
aagtctcagcgcttcccaaatccagtcgccaagttttacgccgccgaggtgactattgcg
ctcgactacttacacagcatgaacatcatctatcgtgatctgaagccagagaacctgctc
ctcgaccgacacggccacatcaagattaccgacttcggcttcgcaaaggaggtacccgac
atcacctggacgctttgcgggacgccagattacctcgcgccagaggtcgtgagcagcaaa
ggctacaacaagagcgtcgactggtggtctctcggaatcctcatcttcgaaatgctcgcg
ggattcacacccttctgggactccggctcgccgctgaaaatctacgaaaacatcctcaag
ggccgcgtcaagtaccctccttacatccacccggacgctcaagatctgctctcgaagctc
atcacggccgacctgaccaagcgtctgggcaacttgcacggcggcagccaggacgtcatg
aaccacgcgtggttcgccgaggtgacgtgggatcggctcgcgaagaaggatatcgatgcg
ccgtatgtgccgcctgtgagaggtggagcgggtgatgcgagtttgttcgataagtatccc
gaggagacggaagcttatggtgccactggcgacgatcctcacaggacgttgttccccgac
ttttga

DBGET integrated database retrieval system