GenomeNet

>abai:IMCC26256_111897 K01426 amidase [EC:3.5.1.4] | (GenBank) amidase, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit (A)
MSSNNSSSNNSSSNNPSVSNRAINELDAVAQAELVRSGDASPSELVEAAIARIDEVNPVL
NAVIHDLRERARAEAADPALPDGAFRGVPFVVKDLDGPLGGAPYHNGNKLLKELGYIAPT
DSTLVAKMRAAGMIAIGKTNTPEFGLQPTTEPEAYGPTHNPWSLAHGPGGSSGGSGAAVA
AGMVAVGHAGDGGGSIRIPASANGLVGLKASRGRISLGPDEGEPWNGFVMRGVLTRSVRD
SGALLDVIAGAVPGDPYAAPSRHGSYANAVTTDPGSLRIGILTSAPSAMCETHPDCVAAT
EEAGRMLESLGHRVEVSSPDALAEDLLTNFLTILSTNVAADLDEIADIAGRAVTAADVEA
ITWSYAEMGRAITGVQVQASLRSIHAWTRRMLSWWDEFDLLLTPTLAEPPPLLGDLARPD
DPGTAAARATPFVAYCAPFNVTGQPAISVPTNISPSGLPIGIQLVSGAWREDLLLSVAGQ
LEQAMPWAQRRPSL

BLAST