GenomeNet

>acp:A2cp1_1135 no KO assigned | (GenBank) Conjugal transfer protein TrbC (A)
MAAVFKRFVFTVALASSATNTEAQGLSRARSTLQNFQSELMLFVPIVAVVSLIILAILWG
LRIIHFRTLAQWGGGVLIVGAASQLVNMLLS

BLAST