GenomeNet

>acs:100554332 K08765 carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21] | (RefSeq) cpt1a; carnitine palmitoyltransferase 1A (A)
MAEAHQAVAFQFTVTPDGIDLRMSHEALRQIYLSGLYSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGLIAKINRTLDITGYMSNQTQNIVSGVLFGTGLWVALIF
SMRYTLKMLLSYHGWMFAEHGKLSTGTKIWMTLVKLFSGRKPMLYSFQTSLPRLPVPSVK
NTVNRYLESVHPLMNEEQFKRMEALGKDFATNLGPKLQWYLKLKSWWAANYVSDWWEEYI
YLRGRGPIMVNSNYFAMDFLYFTPTSVQAARAGNAIHAILLYRRKLDRQQIQPILLMGST
VPLCSAQWERMFNTSRIPGEETDTIQHIKDSKHIVVYHKGCFYKVWLYYDGRLLKPREIE
QQMQWILDDKSKPQPGEEKLAALTAGDRVPWAKARQTYFARGKNKQSLDAIEKAAFFVTL
DDTAQGYREEDPVTTMETYAKSLLHGKCYDRWFDKSFTLIVFKNGKMGLNTEHSWADAPI
VGHLWENVMFSDCLELGYTEDGHCKGESSSGILMPSRLQWEILEECQEVIERSLAVARPL
ADDVDFHSFPFDTFGKGLMKKAKTSPDAFVQLALQLAHYRDMGKFCLTYEASMTRLFREG
RTETVRSCTTQSCKFVKAMDDPSETLEKKIALFKAAATHHQLLYRLAMTGNGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQHIDLNKNPGMESSGGGFGPVADDGYGVS
YIIVGDNLINFHVSSKYSCPETNSHRFGKNIKRALCDIRDMFGIGKNSTK

BLAST