GenomeNet

>aer:AERYTH_09780 no KO assigned | (GenBank) hypothetical protein (A)
MQLRPARDDCGSWHVRRPGPFAVTYWLLSNTVTNLFDAFLGGTLHVWSLFPGARHDGYVG
MLDVTEGERVVAPGLRGFRWVLEVTVDGLVLATVTTGSRTPIVLPHPVAVVVRPRYGVRR
SRLAHTPWRARLTLPSDKVVELVGPWFVLCHAARTLAWPSPTTAR

BLAST