GenomeNet

>aga:AgaP_AGAP010164 K08765 carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21] | (RefSeq) AGAP010164-PA (A)
MAEAHSAVAFSFSITHEGWDINYDREVLDLVWQSGVRSWKKRLARFRTGVRNGVYPAHLQ
SLWLVIAIAVGLHFTQRHVPFDLVNKWLSVLPGDSLQWQLTACSLAGLIVWLSICYTMRY
SLKLLLMYKGWMYEKRAPGSRVSLQTRLWGLFVKVLATWNKPGLYSFQGSLPRLPLPSVQ
DTMQRYLRSVRPLLDDSNYNRMERLAKEFEQGISTKLQRYLFLKSWWSTNYVSDWWEEYV
YLRGRGALMVNSNFYGIDAIFMHPTKVQSARAASVVNLLLQFRRTVERQELEPILVQGLV
PLCSWQYERIFNTVRAPGVETDKIIHYQDSNHIVVLYRGCYYKVIIYHNGRLLRPCELQI
QIEHILQQSEEKPQPGEELLASLTAGDRTKWAQIRQTVFAKGVNRTSLHTVESAAFVLSL
DEKPFEFDLAHPEKLDQFGRYLLHGNGHDRWFDKSFTVCVGSNGRIGFNAEHTWADAPVM
AHVWENIVADEATNKRYDENGNTVGIPEFEPPTPKRLTWDLNDKVALVAIDEAHIAAQKL
LNDVDLRILVHDAYGKGLMKTCRLSPDAFIQMALQLAYYRDAGKFSLTYEASMTRLFREG
RTETVRPCTIESAAWVKAMLDSNVSTVDRVRLLNEACERHQLGYQDAMCGKGIDRHLFCL
YVVSKYLEIDSPFLQEVLSEPWRLSTSQTPHGQTAKMDLKKHPNCISAGGGFGPVADDGY
GVSYIVAGEDLIFFHISSKRSCGTTSSERFAQEICRALADMKHLFEEYRSLQKKNPSNGT
NSDKPQAK

BLAST