GenomeNet

>aje:HCAG_07697 K01900 succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5] | (RefSeq) succinyl-CoA ligase beta-chain, mitochondrial precursor (A)
MFKLVRSNPIAANFRASVRTPIPSRFAQQQRRNLSIHEYLSANLLKTYGVGVPKGEVART
AEEAEAVAKQIDAEDLVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPTEAKMFADQMIGHK
LVTKQTGAQGRICNAVYICERKFARREFYLAILMDRQTQAPVIVSSSQGGVDIETVAKET
PDAITTTSVDINVGVTDEMARNIAKDLGFSEQCLEEAKNTIQKLYKVFMEKDATQIEINP
LCETTEHEVLAMDAKLGFDDNAEFRQKEIFSWRDTTQEDPDEVKAAESGLNFIKLDGDIG
CLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPQAIRAAFELITSDPKVTAIFVNIFG
GIVRCDAIAQGLINVVNEMNLRTPIVARLQGTNMAKAHELINESGLKIFSMEDLQNAAEK
SVQFSKVVKMARDIDVGVEFSLGI

BLAST