GenomeNet

>ajo:RZ95_12635 K02435 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7] | (GenBank) glutamyl-tRNA amidotransferase (A)
MSTSDAQHSADLNAQTVSAIANLARLSLDDTQSAEYAQSLNKILGMMETLKGIDTDGVEP
LKSPFDHPQPLREDVVSETNHRDEYQAIAPQVQDGLYLVPRVIE

BLAST