GenomeNet

>aju:106969394 K03254 translation initiation factor 3 subunit A | (RefSeq) EIF3A; eukaryotic translation initiation factor 3 subunit A (A)
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFTLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYHREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEVDSEWRRGPPEKEWRRGEGRDEERPHRREDDRPRRLGDEEERESSLRADDDRIPRR
GMDEDRGPRRGLDEDRFSRRGADDDRPSWRSADDDRPPRRIGDEDRGSWRHVDDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDEDRGPRRGGADDERSSWRNADDDRGPRRGMDDDRGPR
RGLDDDRGPWRNADDDRISRRGADDDRGPWRSTDDDRIPRRGEDSRPGPWRPFVKPGGWR
EKEKAREESWGPPRESRPSEEREWDREKERERDNQDRDENDKDPEKERERERDREREGDR
EDRFRRPRDEGGWRRGPAEESSSWRDSARRDDRDRDDRRRERDDRRDLRERRDDRDRRGP
PLRSEREEVSSWRRADDRKDERAEEREAPRRVPPPALSRDRERDREREREGEKEKSSWRA
EKDRESLRRTKNETDEDGWTTVRR

BLAST