GenomeNet

>aly:ARALYDRAFT_669657 K01988 lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228] | (RefSeq) hypothetical protein (A)
MENDNCNKKSLSEVLDVRQFRHTNSPVFSTAIFGVIVLLVVAGTIVSNMSLESTFFWSSP
TSEVIQINKMERKSLAPPKNSTSRERIAWLRSHLTEFEIFGSTNLSEQFHQRVVDSLDDK
SEFFGKREILAVESVFKSHPQGCLMIVSGSLDSQQGDSILKPLIDRGYKVFAATPDISLL
LENTPAKSWFQEMKSCKRDPGKIPLQQNLSNLARLAILYKYGGVYLDTDFIVTRSFKGLK
NTIGAQTVVEGDSKNWTRLNNAVLIFEKDHPLVFSFIEEFASTFDGNKWGHNGPYLVTRV
AQRARETTGDNFTVLPPVAFYPFTWLNIPRLFQTPRSSNDSRILKTDLVKLNRESYGLHL
WNKITRKLKIESPNSTVSDNNPPFKPNVPLPRPYGPMSSSCNINSVLDSEYNEKELDPLV
PPRKASKNERIDWFRRKLPELEILKSTTKNKRFHKRVLDLYINNCSAQFFMIWLSPAKSF
GPREMLAVDTLFTTNPGACLAILSNSLDSPRGYTILKPLLDRGFNLIAVTLDIPFLVKNT
PAEAWLKRLKSGHMDPGSIPLFMNLSDLTRLAVLYKYGGVYLDTDIIFLNDMTGLRNAIG
AQSIDPGTKRWTRLNNAVMVFDIYHPLMREFLQEYATTFDGNRWGYNSPYLVSRVIKRLG
NKPGYNLTIFSPDAFYPVNWIKIQKLFKKPATTREAKWVEKTVQDMNKGSYMIHLWNKVT
RKIKIEEGSVMHTLISTHCTVCRNITNSHT

BLAST