GenomeNet

>amx:AM2010_2192 K01991 polysaccharide biosynthesis/export protein | (GenBank) GumB (A)
MSFFRNLLLALAGAGFLAGCATDRSTGMAPGIELTDLASLPAPEGGYVTRVQPGDQLEIN
VVNSELLSGMYIVDDNGELVFPLIGAVAVKGDSPTRVGEKIAQRLSGRYVRNPDVRVVPT
ELSQPTVSIGGEVEKPGAYPARLSRTLARAINNAGGLSEYAKSEDVLVLRTVNGQNYIGA
FNIEAIQRGNYPDPQIYADDIITVGDSPARRRLSQILQFMPLLSTTAILIDRVGR

BLAST