GenomeNet

>aoce:111581460 no KO assigned | (RefSeq) voltage-dependent calcium channel gamma-3 subunit-like (A)
MRLCNRGVMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGMCRSKSQNDNETVRKNEEVLTH
SGLWRTCCTEGTFRGVCKDIDHFPDDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGV
CVAASEFYKSRYNVILSAGILFVSA

BLAST