GenomeNet

>api:100571094 K12323 atrial natriuretic peptide receptor A [EC:4.6.1.2] | (RefSeq) atrial natriuretic peptide receptor 2-like (A)
MSLMSQCDYGRQIFIQTAFYKGNKVALKTLKRSRLELTRPRLLELKRLKDLHHDHLVRFY
GACIEPNYCCLLTEYCPKGSLQDILENEQFKLDWMFRYSLMHDIVKGMCYLHSSELRSHG
GLKSSNCVVDSRFVLKIADFGLRSLRNNHTNESNSDSDSYAYWKGLCNYYFYILQVGAIK
NIYIFGMKYEF

BLAST