GenomeNet

>aplc:110973380 K12818 ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13] | (RefSeq) LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX8-like (A)
MEELDKLEYLSLVSKVCTELDNHLGMNDKDLGKCNIHLHDXYCFSSALQKNGADLPQSFV
SNLLRLIQHMRPPKQAKTANEAKEKKPKVSELDKRRKKYPGLCLPDKKGEVETDEKVAQD
AMDELEALMPLAKMPIKTEKSEDVKTHKKKKNRHHRRSRSRSRSRSSSHDRDRARERRKR
RSWSKSRSRSRDRDRRRRSRSDSRERDSGKDRKHRRKRDRSRDRNRDRDWDKHKDSGSHA
DRFVNRPPPMDPEVGCIYDGKVTSVMQYGCFVQLEGLKRRCEGLVHISELRREGRVADVN
DVVTRGMKVKAKVLSLAGTKIRLSMKDVDQDTGRDLNPMMSKGLAGSSNPEADDALRNPD
RPSNLPLVSVPETDDVSIRKRVQRTTSPEKWELKQMMAANCIDVTELPDFDETTGVLAKE
DDSDEEIEIELREEDPPFLQGHGRQSVELSPVRIVKNPDGTLSKAAMMQSALAKERREMK
QAAERAESENIPTGMNKNWIDPMPDSERALVANVRNMGFTNQDMPEWKKSAFGGNKASYG
KRTKMTIMEQRESLPIFKLKEQLVQAVLDNQILVVIGETGSGKTTQITQYLAEAGYTVRG
KIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECL
IDSDLTQYAIIMLDEAHERTIHTDVLFGLLKKAVKKRSDLKLIVTSATLDAVKFSQYFFE
APIFTIPGRTFPVEILYTKEPEADYLDASLITVMQIHLTEPPGDVLLFLTGQEEIDTACE
ILFERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGI
YYVVDPGFVKQKVYNSKTGMDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDE
MLTTAVPEIQRTNLASTLLSLKAMGINDLLAFDFMDAPPTETLITAMEQLHSLSALDDEG
LLTRLGRRMAEFPLEPMLSKVLIMSVHLGCSEEILTIVSMLSVQNVFYRPKDKQAIADQR
KAKFQQPEGDHLTLLAVYNSWKNNKFSNPWCFENFVQARTLRRAQDVRKQLLGIMDRHKL
DVVTCGKNTARVQKAICSGFFRSAAKKDPQEGYRTLVDSQIVYIHPSSALFNRQPDWVVY
HELVLTTKEYMREVTTIDPRWLVEFAPSFFRVADPTKLSKHKKQQRLEPLYNKYEEPNSW
RISRQRLRRN

BLAST