GenomeNet

>aqu:100640805 K17264 endoplasmic reticulum resident protein 44 | (RefSeq) endoplasmic reticulum resident protein 44-like isoform X1 (A)
MAVVSHSLGLIFILFLEFLACNGDAEFLSRSNMEQFKAGKKLMLINFYADWCRYSAALKP
VYDKAADQVAAETNEAVLVKVDCERDRIFCMQDFRITKYPTIKIIRNGELIRKEYRGQRT
VEALVSFVKKQIESPVHFVSNYAAALEKVEGNTKAAIGFFATNESIEYQNFNKIAFSLKD
ECRFFAIISSDTSAPQLTFREQSGSTDQQFNGDMTSHQAVQSWLSEHCIPLVREITFQNG
EELTEEGLPFFILFYHPDNPDIKAVFKRRVEEELLRHKGSVNFVTADGIKFAHPLSHLGK
SKKDLPVLAIDSFRHMYIFPNFNDIHVPGALNQFVEDLHSGKLHREFHHGPDVSFDSILR
VLHQNSTFQYQPRQPPKEEQKRDSGDTQQPPESTFKKLKPANSRYSFVDHDEL

BLAST