GenomeNet

>arc:ABLL_2190 K11901 type VI secretion system protein ImpB | (GenBank) conserved hypothetical protein (A)
MKQSESPKERINVTYKHSVGEALEDIEIPYKMTILGEFNPSEERKSIEEKKTININKNNF
NEVIKAQNLKLNFDVKNRLNNSNNDSIKIDLDIKHISDFSPEKIVEKVPELKKLMELRQS
LIALKGPLGNVPAFRKAIESLVQDTNKREQLLSELNLITKDNN

BLAST