GenomeNet

>avn:Avin_50850 K11895 type VI secretion system protein ImpH | (GenBank) conserved hypothetical protein (A)
MAATGRNAARPLSERLRREPQAFELLQALLLLEREQPRATPLGSGTAPRAEALRLRGPLT
PLFAASQVQSLENDRQDARPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHGPGEFLD
LFQHRLLSLLYRSLRKHRVALGFEAPQNSPVHDQLRALTGLLPKGLRERQSLPDAAILAR
GALFADGRRSLAGFAAVVRQHFRLPVRAEPYQGAWRPIPPAARSILGRGRRNLSLGRDAV
AGTRIWDEHAGIRLTLGPLEPARAEAFLPDGDAHRQLACLAALHFGPDLDCALRLLVSGA
RPLLLDRRAPPRLNWNGGLRRQPCAAIRHFDTRLRLPEMS

BLAST