GenomeNet

>bac:BamMC406_6677 K11893 type VI secretion system protein ImpJ | (GenBank) type VI secretion protein, VC_A0114 family (A)
MSWFNKVVWSEGLFLLPQLFQQQERYFEHFAHKRAAPLSSFFWGFSQFDIDQESLAFGKL
VFKSGTGIFPDGTPFDVPAHVPPPPPLTIAPEHQNQLIYVAVPLRLPNTEETAFRDQTGS
LARYRAFENELRDSNAIGQGPKPVQLANLRLRLLPEKELTQSWIGIALTRIKALRVDGSV
SLHDTDHIPPVSQYGADPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLL
LQVLNRYEPLLEHICRIRETPPVEFYRELAVMAGELSTFVRPQTRRPLPTPGYDHAQLFG
SIRPLVEEVHYLLNQVLIRGAQPIPLTEQPHGIRVAAVMPAELSGYSSLVLAVGAQMSPD
VLQQQFASQTKISQPQRLPELIRSHLPGLTVVPLPVPPRQIPFNSSYIYYELSRSGPFWE
QIAQQGGLAMHIAGHFPELKVELWGVRHK

BLAST