GenomeNet

>bcar:DK60_2305 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) gatA; aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit (A)
MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAYVAVTHDQARSMAKASD
ERIAKGEAGALEGIPLGVKDLFATKGVHTQACSHILDGFKPEYESTVTANLWADGAVMLG
KLNMDEFAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSSGGSAAAVAAHLCAGATATDT
GGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQAGPIARDVRDAAILMKSMASLDL
KDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDGMPGEIEELWQKGIQYLKDAGAEIV
DISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPGKDIADMYEQTRAAGFGKEVK
RRIMIGTYVLSAGYYDAYYLRAQKVRTLIKKDFEDVFAKGVDAILTPATPSAAFGLADEV
LANDPVKMYLNDIFTVTVNMAGLPGIAVPAGLNGQGLPLGLQLIGRPFEEETLFQAAHVI
EQAAGRFTPAKWW

BLAST