GenomeNet

>bcen:DM39_324 K01560 2-haloacid dehalogenase [EC:3.8.1.2] | (GenBank) HAD hydrolase, IA, variant 3 family protein (A)
MTIKAVVFDFGGVLIDWSPDYLYRQLIPDEAERRWFLTHVCAMDWVVRQDGGQTIEDGTN
ELVAKFPEHEALIRAFYARWHEMIGGELAEGVALVERLDAQRMPLFGLTNWSAQTFPYAW
ENFPVLRRFKDIVVSGRVKLVKPDPAIYREMHARIDPHLPGVAPHELVFIDDNAHNAAAA
TALGWHGIHHTSAASTEARLRELGALA

BLAST