GenomeNet

>bcew:DM40_3591 K18981 uronate dehydrogenase [EC:1.1.1.203] | (GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein (A)
MNATSTGARKPFRRVLLTGAAGNLGRQLRGALANWADIVRVSDIAALDAAAAHEEARVVD
LADRPAVMDLVDGVDAIVHLGGISVDAPFDDLVDANITGTYNLYEAARKYGVKRIVFASS
NHAIGFHPVTEVLDADSPLRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEVPK
NPRMLVTYLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKWWDNAKVAFLGFRPQDSSE
QFAGLFPVTAPTADYDDPAQRYQGGGFVVGEPMERDAK

BLAST