GenomeNet

>bct:GEM_3040 K11896 type VI secretion system protein ImpG | (GenBank) type vi secretion system protein (A)
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIR
GVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGAL
KLSTLRAHLHGEQSFVAALTDCLFVHVLGAYVEPERNGRWTALRKLPIAQAGFDEDDALI
DYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRCQRATLHLVLQDVRSDSHVAR
LLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYEVYSIDSVKLV
RQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQDGGAQTSGISLLRRPTQSVRFERGRAAH
WRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKP
FATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIR
CKPRTGESILA

BLAST