GenomeNet

>bct:GEM_4216 K11893 type VI secretion system protein ImpJ | (GenBank) hypothetical protein (A)
MTEPTMSATPVAALRQRVVWTEGMFLRPQHFQQLERHWERYVALRCLPLQGFYWGFDTLE
LDREQLALGKVALRAAAGVMRDGTPFDLSHPDDLPEPLDVPTDAKDQLVVLALPLWRGGG
EEMSFDAGGNGRGNGNVDVARYVVREYEVADANAVALGPALLQTGRLNVRLMLDTQLTGD
WHALGVARIVERRTDARLLVDGGYIPPRLVAQRDAALLAYTRELHGLLTQRSDALAERLS
EPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVATHPEALFRDWLKLACDLSTFTAAGRR
PQSLAVYVHDDLRTSFAELMTELRRSLSTVLEQNAIQIELRDAGNGIRVATLADPALRDT
AGFVLAVRADVPADSLRTRFPAQAKLGPVERIRDLVQLQLPGITMRQLPVAPRQIPYHAG
HTYFEIDKGSDLWKQLARSGGLAFHFAGEFPGLSMEFWAIRG

BLAST