GenomeNet

>bdl:AK34_2611 K06195 ApaG protein | (GenBank) apaG; protein ApaG (A)
MSQYQFTVSVKTSYLPEQSDPDCRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESHVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH

BLAST