GenomeNet

>bfo:BRAFLDRAFT_114533 K00432 glutathione peroxidase [EC:1.11.1.9] | (RefSeq) hypothetical protein (A)
MFGDKLAILGFPCNQFGHQENATNEEILNSLKYVRPGNGYEPKFDMFSKVQVNGSDAHPV
FAYLREKLPIPADSENAFLIMNDPKCVIWSPVTRTDIAWNFEKFLIGPDGQPIKRFSRYF
QTIDIKNDIEALLK

BLAST