GenomeNet

>bgd:bgla_2g04010 K11893 type VI secretion system protein ImpJ | (GenBank) hypothetical protein (A)
MTQSNKVVWSEGLFLRPQHMQQQERYLERYVELRAGALRPHAWGFQELELESDLLAIGKL
GIKRARGVFPDGTPFAMPGDDPLPPPLDIESNWRDQVVHLTLPLRSATQPDSAWPGADGD
QLYRYRVREAEVRDASGSMEGLTALEVAGMSARLVPDAQPTEGLMRIPVARVVECRADRR
VVLDEGFMPSALNTEAAARLVTFLSELLGLLHQRGEALAGRVAETDRGGAAEIADFLMLQ
VINRYQPLVAHLAAAPLLHPEALYQLLIELAGELATFTAPGKRAQAFPPYRHEMLRESFE
PVIVALRIALSAVLEQSAVPIPLQQRKYGVWVGVVPDLTLLDTATFVLAAKADMKAEDMR
RQLPTQSKIGPVEKIRDLVNLQLPGIGVSPMAVAPRQLPYTSGFLYFECDRNSSMWRMLK
TSGGIAMHFGSGFAGLDLQFWAVRT

BLAST