GenomeNet

>bgf:BC1003_5740 K11895 type VI secretion system protein ImpH | (GenBank) type VI secretion protein, VC_A0111 family (A)
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRVLEKWFAQQAPSATGRSGDIVAQRIAFRNS
LSMSFPPSEIHGAQSYDDEGTALKEKAQRTAALESGSLEKVDITPAFFGLLGGQGALPLH
YTEQIIAREQIKRDRAAREFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAL
AGVADNDTRSSLQSGEGALFDEAIAGYALPTRHRPVSAAYLQRTLSDYFRVPVRVEQFVG
KWYNVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLVIGPLDKADYEAFLPGADRAI
ALERMLTLLAGVTLEYEVKLVLRREAVGPTLLSQGARLGWDAFLCTRDADRDRADARYEL
HVIH

BLAST