GenomeNet

>bgm:CAL15_12845 K10548 putative multiple sugar transport system ATP-binding protein [EC:3.6.3.17] | (GenBank) ABC transporter ATP-binding protein (A)
MAYLLEMRAITKTFPGVKALNRVSLAVRQGEIHAICGENGAGKSTLMKVLSGVYPHGSYD
GDIVYDGEVVRFRSIRDSESRGIVIIHQELALVPQLSIAENLFLGNERAAGGVISWHETF
RQAGALLCKVGLADPPGTVVGTLGVGKQQLVEIAKALSKDVRLLILDEPTAALSEADSQA
LLDLLLGLKAQGITSIIISHKLNEVRRVADRVSVIRDGTTVSTLDAEAGPLCEDRIVRDM
VGRDLSQRYPPRERRAGAAVFEVRDWNVWHPRQPGRQMIRSVSLTVRAAEVVGIAGLMGA
GRTELALSLFGRSYGRDISGEVRVRGRPVDVSDVPRAIEAGMAYVTEDRKSLGLLLEDSL
LRNVTLAGLRRVSRAGVLDRRREIAVAERYQAAMRIRTPSVFQKVGHLSGGNQQKVVLSK
WLFTEPDVLILDEPTRGIDVGAKYEIYGIINELSAQGKAVLMISSELPELLGMCDRIYVM
NEGAFVGELDAEQATQERIMSLIVRDQEQAA

BLAST