GenomeNet

>bgr:Bgr_11080 K02435 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7] | (GenBank) gatC; glutamyl-tRNA (gln) amidotransferase subunit C (A)
MSVDQETVKRVAHLARIAIHDDEIEPVTKKFNAILGFVEQLNEVDVSGVEPLTSVMPMTL
RMREDSVTDGDKAADIVANAPVTEENFFLVSKIVE

BLAST