GenomeNet

>bml:BMA10229_1045 K11902 type VI secretion system protein ImpA | (GenBank) conserved hypothetical protein (A)
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKK
AKDVRVGIWHLRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLG
WLAGPQFLHQLGSSRFEDRDATLNDLIGGRAAAIVEDRDYRLRANTLVHGIQDSLSRIRE
SIAAAEQELNVSRVLDLLSVAASRLTQAQAGGADSASVESDAPVDAPAGASAPGAQQPMA
GPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQRMLGAGFEEVMAELYPEAAS
LVAQLSRPQSSK

BLAST