GenomeNet

>bml:BMA10229_1785 K11897 type VI secretion system protein ImpF | (GenBank) conserved hypothetical protein (A)
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDL
AWLLNTRNGEDGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEP
RIAPDSVEVRSVLDAPGGAAGERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMAL
HPAAGG

BLAST