GenomeNet

>bml:BMA10229_A3017 K10016 histidine transport system permease protein | (GenBank) hisQ-2; histidine ABC transporter, permease protein (A)
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRSRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL

BLAST