GenomeNet

>bmv:BMASAVP1_0601 K11910 type VI secretion system protein VasJ | (GenBank) conserved hypothetical protein (A)
MSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASP
GASGQVDWRAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHW
DAMSPPVSRMRARRGALQWLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAE
RDDDAPTMRAVHAFAERLPVEVVEVVEVADEADVAEAAEAAEAADVADVADVADVADVAD
VADVADVAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAPSAGTDTNANADAARQP
ARLDEAAGRDRALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVCALPETDAENG
RTRIAAPSASIVGAAKNIDEDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGA
DARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPL
SPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRAT
SAEQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALL
IRRDRESAHARTVLDEIASVDAARAMRLSM

BLAST