GenomeNet

>bna:106420427 K08867 WNK lysine deficient protein kinase [EC:2.7.11.1] | (RefSeq) probable serine/threonine-protein kinase WNK4 (A)
MNMNQVSEYVETDPTGRYGRFAEVLGRGAMKTVYKAIDEMLGIEVAWSQVKLKEVLRSSV
DLQRLYSEVHLLSTLNHKSIIRFYTSWIDVHSHTLNFITELFTSGTLRQYKNKYLRIDIR
AIKSWARQILEGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLARMLRDCHAAT
SVIGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNNPAQIYKKVVAGKLP
GAFYRVEDIEAQRFIGKCLVPASKRVSARELLQDPFLASDDSWMVYASGARNLKPFLNEN
EMDRLKLEDNETEELDSEDNKIYLKLPIANENGLAKNVSFCFDIVNDTSIDVATEMVKEL
EITEWDLVEIAKMIDGEISSLVPGWRSEEDDESLHDFHTPYHSSSSPSSSRASLSNYMAP
GRQDWLQDDFHDETYSQSSSNSGSYSNLNYISVDEHISSQPPAMNRTHNVTRFCPEESYH
LHSGQANMYAASSSSSNLRLASDNRVLTRNRSLVDVQGQLLHRSLVEEARKRRLIKTVGD
VENVGFQSPYAVSRKPRSSRR

BLAST