GenomeNet

>bna:106421156 K01280 tripeptidyl-peptidase II [EC:3.4.14.10] | (RefSeq) LOW QUALITY PROTEIN: tripeptidyl-peptidase 2-like (A)
MDLSLQLQIGGTFVXKGPSCSSYWASPSSSTSLSLPRDFISSSPFLHRRLNRRSCSRFRS
RGIRLRRSGSSAMPSSSSETLTASRVDCGGGGGGGGGVACAGADNASVANFKLNESTFLA
SLMPKKEIRADRFLEAHPDYDGRGVVIAIFDSGFDPSAAGLHVTSDGKPKVLDVIDCTGS
GDIDTSTVVKANEDGLIRGASGAPLVVNSSWKNPTGEWRVGCKLVYQLFTDDLTSRVKKE
RRKIWDEKNQEEIAKAVKILYDFDQKHSKVDDTKLKKTREDLQSRVDFLKKQADKYEDKG
PVIDAVVWHDGEVWRVALDTQSLEEDPDCGKLADFSPLTNYRIERKYGVFSRLDACSFVT
NVYDEGKVLSIVTDSSPHGTHVAGIATAHHPEEYLLNGVAPGAQIISCKIGDSRLGSMET
GTGLTRALIAALEHNCDLVNMSYGEATLLPDYGRFVDLVTEAVNKRRLVFVSSAGNNGPA
LTTVGAPGGTTSSIIGVGAYVSPAMAAGAHSVVEPPSEGLEYTWSSRGPTSDGDLGVCIS
APGGAVAPVPTWTLQRRMLMNGTSMSSPSACGAIALLLSAMKAEGIPVSPYSVRRALENT
STPVGDLPEDKLTTGQGLMQVDKAYEYLKQFKDCPCVFYQIKVNLSGKTTPTSRGIYLRE
ATTCRQSTEWTVQVDPKFHEGASNLKELVPFEECLELHSTDEGVVRVPDYLLLTHNGRSF
NVVVDPTNLGDGVHYFEVYGIDCKAPQRGPLFRIPVTIIIPKTVANRPPVISFQQMSFVS
GHIERRYMEVPLGATWAEATIRTSGFDTTRRFYIDTLQLCPLRRPIKWEDAATFASPSAK
SFAFPVVSGQTMELAVAQFWSSGLGSREPTIVDFEIEFHGIGINKEELILDGSEAPIKVE
AEALLASEKLVPVAVLNKIRVPYQPVDAQLKTLSTGRDRLLSGKQILALTLTYKFKLEDA
AEVKPYIPLLNNRIYDNKFESQFYMISDANKRVYAMGDVYPESSKLPKGEYKLQLYLRHE
NVQLLEKLKQLTVFIERNMGEIRLNLHSEPDGPVTGNGVFKSSVLMPGVKEAFYLGPPTK
DKLPKNTPQGSVLVGEISYGKLSFDDKEGKNPKDNPVSYPISFVVPPKKPDEDKKAVSST
NSCKSVSERLEQEVRDTKIKFLGNLKQETEEERSEWKKLCACLKSEYPSYTPLLAKILEG
LLSRSEGGDKISHHEEIIDAANEVVRSVDVDELARFLLDKSEPEDEEAENLKKKMEMTRD
QLAEALYQKGLAMARIENLKGEKEDEGSCQKDKFEENFKELTKWVDVKSSKFGTLTVLRE
KRLSRLGTALKVLDELIQNENETANKKLYELKLGLLEELGWSHLVTYEKQWMQVRFPTSL
PLF

BLAST