GenomeNet

>bna:106426837 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) probable hexokinase-like 2 protein (A)
MTRKVVVVAVTAATVAAAVIIGRWMRRKERRRKQTQRILRKFARECATPVSKLWMVADAM
VAEMTASLAATTASESRGSLNMLVSFAGSLPSGDEKGLRYGANLRGKELLLLRGTLGGNE
EPISDVHKQEISIPEDVLNGSFKELCDYISLELVKFIGMNPGEETEDVKNLGFTLTRYVE
EIRSGSVSAIHRKSLADGDDDKVLKEFVNDMNESLDRHGLKIRMNLALVDDTIGILAGGR
YYHKDTVAAVNLGMGTKAAYIEQAQEVLRWKSTIPNEPQEIVISTEWGDFRSCHLPLTEF
DAALDAESLNPGSHVFEKMASGGYLGEIVRRVLLRMSVESALFGDIVPPKLKTPYILGSP
DMAAMHQDISEDRDIVNKKVKEVFGIMDSTLAAREVVVEVCDVVAERAARVAGAGIVGMI
KKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGAGAL
FFAACDNVKI

BLAST