GenomeNet

>bor:COCMIDRAFT_102635 K01900 succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5] | (RefSeq) hypothetical protein (A)
MYNLARARPLARAVRAAAETPLKRSVIQQRRGLAIHEYRSAALLESYGIGVPKGGVATSG
AEAEKIAQDIGGEDAVIKAQVLAGGRGKGTFDNGFKGGVRVVYSPREAAILAEQMIGHKL
ITKQTGAAGRLCNSVFIVDRKFARREFYLAILMDRASQGPVIVASSQGGMDIETVAKEHP
EAIITTPIDIHKGVTDEVARNIATELGFSEQCIEDAKDTIQKLYKVFMEKDATQIEINPL
SETTDHQVLAMDAKLNFDDNADFRQKEVFDWRDITQEDPDEVKAAKVGLNFIKLDGDIGC
LVNGAGLAMATMDIIKLNGGAPANFLDVGGGATPEAIRQAFELITSDPKVTAIFVNIFGG
IVRCDAIAKGLIQVVQEMNLKTPVIARLQGTNMEAAQKLINDSGLKIFSIDDLQGAAEKS
VQFSKVVKMARDIDVGVEFTLGI

BLAST