GenomeNet

>bov:BOV_1218 no KO assigned | (GenBank) rhomboid family protein (A)
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFE
FMMNFALIPARFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGA
VRMILFWVFTSVVAGLTHYALHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFA
GPVLPIGLTLTLKPVLIFVGVWFLINIVTGLYSTGGADFSSIAWEAHIGGFIAGFFGIPL
MDRPRSYDAVLRR

BLAST