GenomeNet

>bpq:BPC006_II0751 K11904 type VI secretion system secreted protein VgrG | (GenBank) Rhs element Vgr protein (A)
MALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTHVFGGY
DTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTY
EPREYCVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYL
PDGEESRAIQGREGVQRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPL
EYYDYAAGYREPEQGERLARLRLEAIQAESHTLVGEANARALATGRAFTLIGHPALGRNR
RYYVTNSELTFIQDGPDSTSQGRNVAVKFRALVDDQPFRPLLTTPRPEVPGIQSATVVGP
EMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWGVIAMPRVGQEVLVTY
VDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDDQRGAE
RVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTG
VSASFTGVSTSFTGVSTSFTGVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTS
LTGSSNSVTGVSNSMTGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGT
STSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVST
TGFSFSYTGVSYSDTGIDLKKVGMQVKS

BLAST