GenomeNet

>bprs:CK3_19150 K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (GenBank) EMAP domain (A)
MDKMAEKEEVTAETSTEDAEKVVVEPYDAADIDFDTFCKSDMRVVKVKDCVAVKKSKRLL
QFTLDDGSGTDRTILSGMHSYYEPEELVGKTLVAIVNIPPRAMMGIVSHGMFLSAECKKG
KMRL

BLAST