GenomeNet

>bpse:BDL_5571 K07169 FHA domain-containing protein | (GenBank) FHA domain protein (A)
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDA
CLLKNLSSVSTIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATAA
AAAAPAASAAQAQAKGAGNKLWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPR
DLNQLSTDPLDLFAQPHGDPDARAGAVREGEDRAPPTVTQPDHAPEWTQHVRVQPAQSAP
PAASRPGAPAARSGDIPAADDASDMPSRVRASPAPAPATPETLLQAFFEGAGLDTTAEQH
HWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLKLLPDGSAVL
RQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR

BLAST