GenomeNet

>bsc:COCSADRAFT_109913 K20184 vacuolar protein sorting-associated protein 41 | (RefSeq) hypothetical protein (A)
MAAENIDDAPLPKARDDSHLQKPQQTIEPDSDDEEDDDDTADDDVDEEPKLKYSRLTRDL
GPIYRNGDATATFMVAGDKMIIGTHNGNIHALNLPAFNILRTYNAHPAASVTALSVSPLL
ASQPFVPSASDLRSADQASASSRRTDSPAGNTSSPRAPRQAQVPPTPSNQIYIASSSIDG
HVCVSSLVDPKDVTLRNFGRPVQAVALSPDYKNDRSYLSGGLAGELIHTVGGPIGVRSNA
NTSAASQAAHGWLGAIGLGGHGGRDTILHSGEGTITAIKWSLSGKFVAWANEHGVRLMRT
DLHLDSADSDDAWKRIGIIEKPNRRVWQDMASVWKPRIEWIDDQSLESDDDAIMSMNGHH
LVDKADATLPHNRSSQPAKEGNKKNIEKLIIGWGDTAWIVHVRPGGAGVGRNVGERSVGT
ADVIRCIHFDDCIVSGISLYTPSLLLVLAYRTRDDDDNPVSGPDTTPRGGRQRRTNGLSP
ELKLIDAATSDEVEVDSLTVSRYESLSAADYHLGTLYVPHPKTMTPAQRSALEAIGGGIW
DVGASAARIFSSGASVMNLQIGSDKPPSRAPSMSSASAGNISGSTPTKRQQPVHPNAASA
GLKVFIQSPYDCVLAIKRELSDHFQWELEHENYKDAWELLEDHPEIISSVVQIPSDASDT
GTPVNKQGSLHEFFADDNSQTTLSATRANQNSAVEKEKRRIGDLWVQQLVSAGDWKQAGK
VAGRVLGTSARWEHWVWKFAQTNHFNEISPYVPKKPIQPPLPSMVYEVILGHYIIHDRIR
FKHLLEDWDPDLFDINSVIEAIKSKLSAGDVTEESIEGDVQGRDWRILQDGLAKLFLASG
RQREALRCYIRLQNSEAAMTLIRDFHLVEAVRDDIPGFIMMGVSKELMKSASTKLEELEE
ASAEAINVLVEEGCRGTIPASDVESQLQAKGPSFRPFLHFYLRKLWKPEMHERTAKTAKE
RVAEDRLVADGKLVAEEFADLMVELFAEYDRPLLMEYLRKSQSYDLSKATAECERREYIP
ELVHILSKTGQTKRALYLIIEKLSDVSFAISFAKEQDDPDLWNDLLEYSMDKPHFIRGLL
EEVGTAIDPIKLVRRIPEGLEIEGLRDGIGRMVREYEIQYSISEGVARVLRGEVAAGMDT
LRSGQKRGVKFEVVPCNGGLSGKQAKHHHAKGQIDIETKGMDPATAAKLTAKAEKSTKAV
NTANTPTIDPTPPGPTEGDAPPGHCVGCHRPFTLPTAEEESAITDGTTPLPPSRDTLVGF
ACGHVFHLACLLPRTNASASVAAGLQQQLANDAQESGGRWTRSVGAKVAHAHVIKKAVGR
GCVVCREREVVGTE

BLAST